Gene Oeu061953.1
| Sequence ID | Oeu061953.1 add to my list |
|---|---|
| Species | Olea europaea |
| Alias | No gene alias |
| Length | 141aa |
Length: 141 amino acids
>Oeu061953.1_OLEEU MDAKHLAAYLKEKLQRSVEIIPPKKAEGSGNKKEKEGGGEKKDDAKATTGGGEGSEGKKV EINKMEFNGYNPETHYAVPMYNQSYANQGYGVPMYPHHQDYAYTGHAAHYAPGPPPPPPP TYLHETDQMFSDENPNACFVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP023608 | Unannotated cluster |
| 3 | GP040483 | Unannotated cluster |
| 4 | GP505423 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_452_22.1 | orthology | 0.595 | 2 | - | - |
| Ca_52_14.1 | orthology | 0.59 | 1 | - | - |
| Ca_7_292.1 | orthology | 0.595 | 2 | - | - |
| Cc06_g04230 | orthology | 0.583 | 2 | - | - |
| DCAR_014996 | orthology | 0.689 | 4 | - | - |
| DCAR_017683 | orthology | 0.673 | 4 | - | - |
| HanXRQChr01g0027741 | orthology | 0.817 | 4 | - | - |
| HanXRQChr13g0401031 | orthology | 0.88 | 4 | - | - |
| HanXRQChr14g0454431 | orthology | 0.755 | 4 | - | - |
| HanXRQChr17g0570331 | orthology | 0.743 | 4 | - | - |
| Oeu005022.1 | ultra-paralogy | 0.4 | 0 | - | - |
| Oeu016984.1 | ultra-paralogy | 0.129 | 0 | - | - |
| Oeu019283.1 | ultra-paralogy | 0.157 | 0 | - | - |
| Oeu045227.1 | ultra-paralogy | 0.548 | 0 | - | - |
| PGSC0003DMP400006915 | orthology | 0.562 | 5 | - | - |
| Solyc09g008200.2.1 | orthology | 0.602 | 5 | - | - |
| Solyc10g086280.1.1 | orthology | 0.743 | 4 | - | - |
| capan_pan_p000093 | orthology | 0.869 | 4 | - | - |
| capan_pan_p021581 | orthology | 0.623 | 4 | - | - |
| ipotf_pan_p002813 | orthology | 0.716 | 4 | - | - |
| ipotf_pan_p014346 | orthology | 0.643 | 4 | - | - |
| itb06g04100.t1 | orthology | 0.635 | 4 | - | - |
| itb15g00310.t1 | orthology | 0.72 | 4 | - | - |