Gene PGSC0003DMP400010945
| Sequence ID | PGSC0003DMP400010945 add to my list | ||
|---|---|---|---|
| Species | Solanum tuberosum | ||
| Alias | No gene alias | ||
| Length | 153aa | ||
| Gene Annotation | PGSC0003DMT400015784 Protein | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 153 amino acids
>PGSC0003DMP400010945_SOLTU MGVLDHISDMFDCSSQHSKHKRRKQLQTVEIKVKMDCEGCERKVRRSVEGMKGVSSVTIE PKQHKLTVVGYVDPEKVVARVAHRTGKKAEIWPYVPYDVVAHPYAQGVYDKKAPAGYVRR DDFQTNQLARASSTEVRYTTAFSDENPAACVVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for PGSC0003DMP400010945
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| HanXRQChr10g0300861 | orthology | 0.259 | 1 | 251.5 | 5.4e-67 |
| HanXRQChr13g0397081 | orthology | 0.25 | 1 | 254 | 4.01e-88 |
| ipotf_pan_p020143 | orthology | 0.132 | 3 | 281 | 4.32e-99 |
| itb10g25800.t1 | orthology | 0.132 | 3 | 280.4 | 7.8e-76 |