Gene PGSC0003DMP400011529


Sequence ID PGSC0003DMP400011529  add to my list
Species Solanum tuberosum
Alias No gene alias
Length 221aa
Gene Annotation PGSC0003DMT400016647 Protein
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 221 amino acids

>PGSC0003DMP400011529_SOLTU
MSKEEKKIEVTSAVYKVGLHCPKCAHDIRKPLLTTQGVHSVDVKFEKDEVTVKGAIDANK
IHQRLQKWTKNKVHLVSQAKIENANQLKKETIKTTTLNVYMHCNKCEVDLERRLLKHKGI
YSVKTNFKAQTITVETILESEKLVTYVTKTFGKHAEIVKKKEEEKKEIKKEKVNIEEKTI
EFKELKKVEAKTKEGEIPYFVHYVYSPQWFSDDNPNACYVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545		 Heavy metal transport/detoxification group1
3 GP342504 Unannotated cluster
4 GP464372 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for PGSC0003DMP400011529



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_46_563.1 orthology 0.511 5 - -
Ca_64_447.2 orthology 0.507 6 199.9 4.5e-51
Cc02_g26130 orthology 0.507 6 221.5 4.9e-58
DCAR_029550 orthology 0.661 5 216.9 1.5e-56
HanXRQChr06g0168381 orthology 0.74 6 157.5 1.5e-38
Oeu036922.1 orthology 0.49 5 62.8 5.53e-13
Solyc10g039390.1.1 orthology 0.136 1 329.3 1.9e-90
capan_pan_p023451 orthology 0.277 2 167 2.35e-53
ipotf_pan_p011107 orthology 0.375 4 271 1.18e-92
itb09g19040.t1 orthology 0.398 4 166 3.1e-41