Gene PGSC0003DMP400018109
| Sequence ID | PGSC0003DMP400018109 add to my list |
|---|---|
| Species | Solanum tuberosum |
| Alias | No gene alias |
| Length | 108aa |
| Gene Annotation | PGSC0003DMT400026532 Protein |
Length: 108 amino acids
>PGSC0003DMP400018109_SOLTU MNMQKVTVTGWADQKKILKTVRKTGKRAELWPYPYNPEYHNYMHHYYYDTFYSRPGTYYA PPSSYNYRVHGYNGHAHGSYAELPYNTIFDERTRHMFSDDNATGCSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_23_1086.1 | orthology | 0.43 | 3 | 103 | 1.12e-29 |
| Ca_24_186.3 | orthology | 0.441 | 4 | - | - |
| Ca_42_221.2 | orthology | 0.441 | 5 | - | - |
| Ca_66_295.2 | orthology | 0.441 | 5 | - | - |
| Cc02_g14880 | orthology | 0.419 | 4 | 110.2 | 7.7e-25 |
| Oeu043106.1 | orthology | 0.538 | 4 | 104.8 | 5.6e-23 |
| Solyc02g076880.2.1 | orthology | 0.0236 | 1 | 175.3 | 2.3e-44 |
| capan_pan_p000797 | orthology | 0.0723 | 2 | 174 | 9.81e-58 |
| ipotf_pan_p011098 | orthology | 0.467 | 6 | 125 | 1.1e-38 |
| itb10g02670.t1 | orthology | 0.441 | 6 | 106.3 | 1.4e-23 |