Gene PGSC0003DMP400024192
Sequence ID | PGSC0003DMP400024192 add to my list | ||
---|---|---|---|
Species | Solanum tuberosum | ||
Alias | No gene alias | ||
Length | 281aa | ||
Gene Annotation | PGSC0003DMT400035571 Protein | ||
Gene Ontology |
Display term(s) (1)
|
Length: 281 amino acids
>PGSC0003DMP400024192_SOLTU MSYSLVSPNTFALKLKIHCKICEKKLRNMLLKIQGVQSVQIDEKLGNLVISGTVDPTTIL TMLEKLGRKAELLWEQGQPINVQTITQSKVINSLNDSDIITRQLEQLSRIPGLQTMEVIT TIRLTIQGESRNDPSDKVLEIRTTNNLNKPSHPFDHSQGDGDGGGGFCAASSSCCGCHHD AITHSHNTHGCCCHGGNTSKNSCWGKAHPSDSQPPLAPSGSQPPLALTPPSWSSGSTIAS APPLPYDFYHYQAPPPPSSSPIHHTYYNALSDENANGCAIL
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP549804 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for PGSC0003DMP400024192
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_25_98.1 | orthology | 0.993 | 4 | 121.3 | 2.6e-27 |
Ca_63_138.6 | orthology | 0.993 | 4 | - | - |
Ca_78_564.2 | orthology | 1 | 4 | - | - |
Cc02_g07920 | orthology | 0.998 | 4 | 120.9 | 1.1e-27 |
capan_pan_p030739 | orthology | 0.295 | 1 | 224 | 2.95e-72 |
capan_pan_p038035 | orthology | 0.303 | 1 | - | - |
capan_pan_p041830 | orthology | 0.3 | 1 | - | - |
ipotf_pan_p023915 | orthology | 0.832 | 3 | - | - |
ipotf_pan_p024814 | orthology | 0.823 | 2 | 152 | 6.58e-45 |
itb02g05420.t1 | orthology | 0.845 | 3 | 143.7 | 2.1e-34 |