Gene PGSC0003DMP400025270
| Sequence ID | PGSC0003DMP400025270 add to my list | ||
|---|---|---|---|
| Species | Solanum tuberosum | ||
| Alias | No gene alias | ||
| Length | 139aa | ||
| Gene Annotation | PGSC0003DMT400037204 Protein | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 139 amino acids
>PGSC0003DMP400025270_SOLTU MSIMVEVRVPNLDCEGCASKLRKAIFKLKGVETIDIDMETQKVTARGYGLEEKKVLKAIK RAGKAAEPWPYPVGYSHFASFYQYPNHIISHYYDTSRNVAAPSVHTFFHTPSVYSVAVAS DEAVASLFSDDNPHACTIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for PGSC0003DMP400025270
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G48970.1 | orthology | 0.507 | 11 | 211.5 | 3.5e-55 |
| AUR62015981-RA | orthology | 0.46 | 10 | 222.6 | 2.6e-58 |
| Bv3_055490_mxet.t1 | orthology | 0.493 | 10 | 216.5 | 1e-56 |
| Ca_8_1007.1 | orthology | 0.213 | 5 | 245.4 | 5.9e-65 |
| Cc02_g02970 | orthology | 0.213 | 5 | 245.4 | 2e-65 |
| Cg9g026790.1 | orthology | 0.307 | 11 | 225.3 | 2.2e-59 |
| Cm028340.1 | orthology | 0.307 | 11 | 225.3 | 3.7e-59 |
| Cs9g17280.1 | orthology | 0.307 | 11 | 225.3 | 2.4e-59 |
| DCAR_009368 | orthology | 0.314 | 9 | 236.9 | 8.7e-63 |
| FvH4_7g29520.1 | orthology | 0.346 | 12 | 220.3 | 7.5e-58 |
| HanXRQChr06g0183831 | orthology | 0.384 | 6 | 209.9 | 1.6e-54 |
| HanXRQChr09g0253621 | orthology | 0.411 | 6 | - | - |
| MELO3C003319.2.1 | orthology | 0.443 | 10 | 186.4 | 1e-47 |
| Manes.14G025900.1 | orthology | 0.38 | 12 | 235 | 3.4e-62 |
| Mba01_g04690.1 | orthology | 0.563 | 9 | 188 | 4.6e-48 |
| Oeu024220.1 | orthology | 0.21 | 6 | 242.3 | 2.9e-64 |
| Solyc03g025790.2.1 | orthology | 0.0277 | 1 | 280.4 | 6.5e-76 |
| brana_pan_p044950 | orthology | 0.48 | 12 | 214 | 1.15e-72 |
| braol_pan_p025375 | orthology | 0.48 | 13 | 217 | 4.73e-74 |
| brarr_pan_p005835 | orthology | 0.48 | 13 | 217 | 4.22e-74 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 | orthology | 0.356 | 13 | 223.4 | 1e-58 |
| capan_pan_p012989 | orthology | 0.0878 | 2 | 272 | 4.81e-96 |
| cucsa_pan_p007884 | orthology | 0.41 | 10 | 193 | 1.76e-64 |
| evm_27.model.AmTr_v1.0_scaffold00076.26 | orthology | 0.527 | 7 | 187.2 | 5.3e-48 |
| ipotf_pan_p019855 | orthology | 0.137 | 4 | 248 | 1.34e-86 |
| ipotf_pan_p021461 | orthology | 0.309 | 4 | - | - |
| itb03g13280.t1 | orthology | 0.137 | 4 | 246.9 | 8.7e-66 |
| itb12g25750.t1 | orthology | 0.296 | 4 | - | - |
| maldo_pan_p005834 | orthology | 0.352 | 12 | 225 | 2.55e-77 |
| maldo_pan_p046866 | orthology | 0.777 | 12 | - | - |
| medtr_pan_p031372 | orthology | 0.339 | 11 | 228 | 1.29e-78 |
| musac_pan_p029616 | orthology | 0.55 | 9 | 191 | 1.04e-63 |
| phavu.G19833.gnm2.ann1.Phvul.004G116300.1 | orthology | 0.354 | 13 | 226.5 | 1.1e-59 |
| soybn_pan_p030070 | orthology | 0.33 | 12 | 192 | 1.15e-64 |
| thecc_pan_p002573 | orthology | 0.327 | 12 | 230 | 1.62e-79 |
| vitvi_pan_p028565 | orthology | 0.273 | 7 | 226 | 5.98e-78 |