Gene PGSC0003DMP400030742
Sequence ID | PGSC0003DMP400030742 add to my list | ||
---|---|---|---|
Species | Solanum tuberosum | ||
Alias | No gene alias | ||
Length | 300aa | ||
Gene Annotation | PGSC0003DMT400045360 Protein | ||
Gene Ontology |
Display term(s) (1)
|
Length: 300 amino acids
>PGSC0003DMP400030742_SOLTU MKDMFCASQAATAICLSMEELGSSSSSSSVIQLGGGSISGSRAIDRYNPIIRDSRRTGPK SISAPCSARSPISPKAQSKSRKSTSKESKRSKGVSKKLLIEKDDEKRKSSVSEGNENIFK TSSWSCKKPGEFITPPGSSRYLLSEKNILDALSDFEPVLKLVDSSSSSSVLEDVKTETHE SCPPPSASANQVVVLRVSLHCRGCERKMRKHISRMQGVKSFNIDFAAKKVTVTGDVTPLG VLASISKVKNAQLWTPTLASSVPTAKVNLSNSELNNDKQMVLSHEKIENVTPTTTTIQLM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP469447 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for PGSC0003DMP400030742
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AUR62010447-RA | orthology | 0.948 | 5 | - | - |
AUR62030468-RA | orthology | 0.761 | 5 | 162.5 | 6.7e-40 |
Bv5_103030_anmg.t1 | orthology | 0.842 | 5 | 177.6 | 1.1e-44 |
Solyc10g085910.1.1 | orthology | 0.0247 | 1 | 497.7 | 5.6e-141 |
capan_pan_p021656 | orthology | 0.0993 | 2 | 457 | 4.71e-164 |
ipotf_pan_p006474 | orthology | 0.714 | 5 | 194 | 2.44e-60 |
itb09g27700.t1 | orthology | 0.712 | 5 | 189.9 | 2.7e-48 |