Gene PGSC0003DMP400045992
| Sequence ID | PGSC0003DMP400045992 add to my list | ||
|---|---|---|---|
| Species | Solanum tuberosum | ||
| Alias | No gene alias | ||
| Length | 326aa | ||
| Gene Annotation | PGSC0003DMT400068079 Protein | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 326 amino acids
>PGSC0003DMP400045992_SOLTU MGEEEKKPAEEVKKTEGEKKEDAPKSDEKTEEKKTEEAPAPPPPPQEIVLRVYMHCEGCA RKVRKSLKGFQGVEDVLTDCKSHKVVVKGEKADPLKVLERVQKKSHRKVELLSPIPKPPA EEAKKPEEKEVVKPEEKKEEPPQVITVVLKVHMHCEACSQEIKRRIQKMKGVENAEPDLK NSQVSVKGIFEATQLVDYVSRRTGKRAVIVKVEPEKKGEEKPKEEKKTEEGEKDAKKAEE EEKKANGGDSASAVTAAAPSEGAANKEVGVQEEDPKLEMKKNEFYYYYPQQPNYHLYPQT YASHEMYNPYPPQMFSDENPNACSVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP040674 | Unannotated cluster |
| 4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for PGSC0003DMP400045992
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Solyc03g097380.2.1 | orthology | 0.0625 | 1 | 298.1 | 7e-81 |
| capan_pan_p023481 | orthology | 0.156 | 2 | 307 | 3.34e-104 |
| ipotf_pan_p012033 | orthology | 0.412 | 4 | 261 | 1.32e-85 |
| ipotf_pan_p015819 | orthology | 0.424 | 4 | - | - |
| itb02g17790.t1 | orthology | 0.4 | 4 | - | - |
| itb11g13550.t1 | orthology | 0.444 | 4 | 228.4 | 7.5e-60 |