Gene PGSC0003DMP400053758
| Sequence ID | PGSC0003DMP400053758 add to my list |
|---|---|
| Species | Solanum tuberosum |
| Alias | No gene alias |
| Length | 97aa |
| Gene Annotation | PGSC0003DMT400079287 Protein |
Length: 97 amino acids
>PGSC0003DMP400053758_SOLTU MEKVTVVGYVDRNRVLKAVRRHGKRAEFWPYPNPPLYFTTSNNYFKDMTSEYRDSYNYWR HGYNVADKHGNLHVTHRGDDKVSNLFNDDNVNACCLM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| PGSC0003DMP400053782 | ultra-paralogy | 0.001 | 0 | - | - |
| Solyc08g075880.2.1 | orthology | 0.0207 | 1 | - | - |
| capan_pan_p027336 | orthology | 0.0887 | 2 | - | - |