Gene PGSC0003DMP400053782
| Sequence ID | PGSC0003DMP400053782 add to my list | ||
|---|---|---|---|
| Species | Solanum tuberosum | ||
| Alias | No gene alias | ||
| Length | 180aa | ||
| Gene Annotation | PGSC0003DMT400079324 Protein | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 180 amino acids
>PGSC0003DMP400053782_SOLTU MVNVLEKLFGSFVSAITSYCVFQYHHPHHQQGTNKHKMTKATRPLSLQTVELKVRMCCSG CERVIKDAVYKLRGVESVSVELEMEKVTVVGYVDRNRVLKAVRRHGKRAEFWPYPNPPLY FTTSNNYFKDMTSEYRDSYNYWRHGYNVADKHGNLHVTHRGDDKVSNLFNDDNVNACCLM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for PGSC0003DMP400053782
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| PGSC0003DMP400053758 | ultra-paralogy | 0.001 | 0 | - | - |
| Solyc08g075880.2.1 | orthology | 0.0207 | 1 | 336.7 | 9.9e-93 |
| capan_pan_p027336 | orthology | 0.0887 | 2 | 328 | 1.16e-116 |