Gene Solyc02g083550.1.1
| Sequence ID | Solyc02g083550.1.1 add to my list | ||
|---|---|---|---|
| Species | Solanum lycopersicum | ||
| Alias | No gene alias | ||
| Length | 159aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 159 amino acids
>Solyc02g083550.1.1_SOLLC MGFLDHLSELCEFHRGTSRRKLSKLWRNQLETVEIRVKMDCEGCERRVRKSVQGMRGVTK VEVEPKKHKLTVIGYVDPDKVLRRVRHRTGKKAEFWPYVPYDLVDHPYVRGVYDKKAPPG YVRNVYDNPQVSNLARASSTEVNYITAFSDENPQACIIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Solyc02g083550.1.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_84_43.1 | orthology | 0.436 | 3 | - | - |
| Cc07_g11100 | orthology | 0.39 | 3 | 243.8 | 6.6e-65 |
| HanXRQChr09g0256841 | orthology | 0.363 | 3 | 236.9 | 1.4e-62 |
| PGSC0003DMP400006528 | orthology | 0.0424 | 2 | 320.9 | 5e-88 |
| capan_pan_p026596 | orthology | 0.117 | 2 | 291 | 7.26e-103 |