Gene Solyc03g025790.2.1
Sequence ID | Solyc03g025790.2.1 add to my list | ||
---|---|---|---|
Species | Solanum lycopersicum | ||
Alias | No gene alias | ||
Length | 139aa | ||
Gene Ontology |
![]()
|
Length: 139 amino acids
>Solyc03g025790.2.1_SOLLC MSIMVEVRVPNLDCEGCAAKLRKALFKLKGVETIDIDMETQKVTARGYGLEEKKVLRAIK RAGKAAEPWPYPVGYSHFASFYQYPNHIVSHYYDTSRNVAAPSVHTFFHTPSVYSVAVAS DEAVASLFSDDNPHACTIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Solyc03g025790.2.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AT3G48970.1 | orthology | 0.497 | 11 | 210.3 | 7.7e-55 |
AUR62015981-RA | orthology | 0.45 | 10 | 221.5 | 5.7e-58 |
Bv3_055490_mxet.t1 | orthology | 0.483 | 10 | 215.3 | 2.2e-56 |
Ca_8_1007.1 | orthology | 0.203 | 5 | 245 | 7.7e-65 |
Cc02_g02970 | orthology | 0.203 | 5 | 245 | 2.6e-65 |
Cg9g026790.1 | orthology | 0.297 | 11 | 224.6 | 3.8e-59 |
Cm028340.1 | orthology | 0.297 | 11 | 224.6 | 6.4e-59 |
Cs9g17280.1 | orthology | 0.297 | 11 | 224.6 | 4.1e-59 |
DCAR_009368 | orthology | 0.304 | 9 | 236.5 | 1.1e-62 |
FvH4_7g29520.1 | orthology | 0.337 | 12 | 219.2 | 1.7e-57 |
HanXRQChr06g0183831 | orthology | 0.374 | 6 | 208.8 | 3.6e-54 |
HanXRQChr09g0253621 | orthology | 0.401 | 6 | - | - |
MELO3C003319.2.1 | orthology | 0.433 | 10 | 185.3 | 2.3e-47 |
Manes.14G025900.1 | orthology | 0.369 | 12 | 236.5 | 1.2e-62 |
Mba01_g04690.1 | orthology | 0.553 | 9 | 186.8 | 1e-47 |
Oeu024220.1 | orthology | 0.2 | 6 | 240.4 | 1.1e-63 |
PGSC0003DMP400025270 | orthology | 0.0277 | 1 | 280.4 | 6.5e-76 |
brana_pan_p044950 | orthology | 0.47 | 12 | 213 | 2.32e-72 |
braol_pan_p025375 | orthology | 0.47 | 13 | 216 | 9.55e-74 |
brarr_pan_p005835 | orthology | 0.47 | 13 | 216 | 8.51e-74 |
cajca.ICPL87119.gnm1.ann1.C.cajan_41314.1 | orthology | 0.346 | 13 | 222.6 | 1.7e-58 |
capan_pan_p012989 | orthology | 0.0778 | 2 | 273 | 2.38e-96 |
cucsa_pan_p007884 | orthology | 0.4 | 10 | 192 | 3.54e-64 |
evm_27.model.AmTr_v1.0_scaffold00076.26 | orthology | 0.517 | 7 | 188.3 | 2.4e-48 |
ipotf_pan_p019855 | orthology | 0.127 | 4 | 252 | 4.01e-88 |
ipotf_pan_p021461 | orthology | 0.299 | 4 | - | - |
itb03g13280.t1 | orthology | 0.127 | 4 | 250.4 | 7.9e-67 |
itb12g25750.t1 | orthology | 0.286 | 4 | - | - |
maldo_pan_p005834 | orthology | 0.342 | 12 | 224 | 5.16e-77 |
maldo_pan_p046866 | orthology | 0.767 | 12 | - | - |
medtr_pan_p031372 | orthology | 0.329 | 11 | 228 | 2.6e-78 |
musac_pan_p029616 | orthology | 0.54 | 9 | 190 | 2.1e-63 |
phavu.G19833.gnm2.ann1.Phvul.004G116300.1 | orthology | 0.344 | 13 | 225.7 | 1.8e-59 |
soybn_pan_p030070 | orthology | 0.32 | 12 | 192 | 1.15e-64 |
thecc_pan_p002573 | orthology | 0.317 | 12 | 229 | 3.27e-79 |
vitvi_pan_p028565 | orthology | 0.263 | 7 | 226 | 1.21e-77 |