Gene Solyc03g080100.2.1
Sequence ID | Solyc03g080100.2.1 add to my list | ||
---|---|---|---|
Species | Solanum lycopersicum | ||
Alias | No gene alias | ||
Length | 292aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 292 amino acids
>Solyc03g080100.2.1_SOLLC MGEETKQEPPKEEVKTEEEQTEPKPPSPFVLYVDLHCVGCAKKIERSISKIRGVEGVVIE MAKNTVTIKGVIEPQAVCDRITKKTKRVAKVLSPLPAAEGEPIPQVVASQVSGLTTVELN VNMHCEACAEQLKKKILRMKGVRSAETEASTGKVTVTGTMDANKLVDYVYRRTKKQAKIV PQPEPEPEKPVEETKPDEAKPVEEPTPEDKKDEGTPPTENKEGGDGEKPPEGEKNEGGGG GEAMIIPIEDHYDEHTINKLMYYHPYQPLYVIERIPPPQLFSDENPNACCIT
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP126431 | Unannotated cluster |
4 | GP077890 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Solyc03g080100.2.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
PGSC0003DMP400001116 | orthology | 0.0345 | 1 | 387.9 | 6.1e-108 |
capan_pan_p010502 | orthology | 0.107 | 2 | 388 | 9.01e-137 |
ipotf_pan_p017710 | orthology | 0.291 | 4 | 298 | 2.63e-101 |
itb03g24840.t1 | orthology | 0.287 | 4 | 273.9 | 1.4e-73 |