Gene Solyc03g098650.2.1
| Sequence ID | Solyc03g098650.2.1 add to my list | ||
|---|---|---|---|
| Species | Solanum lycopersicum | ||
| Alias | No gene alias | ||
| Length | 130aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 130 amino acids
>Solyc03g098650.2.1_SOLLC MVYWEFFVGEAEFKISMYCQGCEKQIAKIISKIKGVEEFMTDMNNHKVLVKGRINADKVL KKLKKKTGKKVEMVIKEEESKKNSEEIEGDLQLMKQNPREITEALVIGYCGDSMLYTMFS DENANACSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP343847 | Unannotated cluster |
| 4 | GP466810 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Solyc03g098650.2.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AT3G21490.1 | orthology | 1 | 8 | 109.4 | 1.7e-24 |
| Ca_27_985.2 | orthology | 1 | 5 | - | - |
| Ca_34_139.2 | orthology | 1 | 5 | - | - |
| Ca_43_446.2 | orthology | 1 | 4 | - | - |
| Cc03_g02440 | orthology | 1 | 4 | 113.6 | 8.4e-26 |
| Cg9g003840.1 | orthology | 1 | 7 | 77.8 | 5.4e-15 |
| Cm135610.1 | orthology | 1 | 7 | 96.3 | 2.5e-20 |
| Cs9g05250.1 | orthology | 1 | 6 | 75.9 | 2.2e-14 |
| DCAR_030575 | orthology | 1 | 3 | 107.8 | 5.7e-24 |
| FvH4_3g29750.1 | orthology | 1 | 6 | 115.9 | 1.9e-26 |
| FvH4_4g16960.1 | orthology | 1 | 6 | - | - |
| HanXRQChr08g0226491 | orthology | 0.951 | 1 | 107.8 | 8.1e-24 |
| MELO3C021374.2.1 | orthology | 1 | 7 | 107.1 | 7.5e-24 |
| Manes.15G018700.1 | orthology | 1 | 6 | 83.6 | 1.2e-16 |
| brana_pan_p026722 | orthology | 1 | 10 | 91.7 | 1.58e-24 |
| braol_pan_p034893 | orthology | 1 | 9 | 91.3 | 2.03e-24 |
| braol_pan_p054032 | orthology | 1 | 8 | - | - |
| brarr_pan_p010495 | orthology | 1 | 10 | 91.7 | 1.28e-24 |
| cajca.ICPL87119.gnm1.ann1.C.cajan_04222.1 | orthology | 1 | 8 | 110.5 | 8.8e-25 |
| cicar_pan_p022803 | orthology | 1 | 8 | 92.8 | 1.14e-25 |
| cucsa_pan_p017292 | orthology | 1 | 7 | 110 | 2.26e-32 |
| medtr_pan_p033077 | orthology | 1 | 8 | 96.7 | 8.56e-27 |
| phavu.G19833.gnm2.ann1.Phvul.003G099700.1 | orthology | 1 | 9 | 100.5 | 8.3e-22 |
| soybn_pan_p008694 | orthology | 1 | 9 | - | - |
| soybn_pan_p032351 | orthology | 1 | 9 | 103 | 2.81e-29 |
| thecc_pan_p001371 | orthology | 1 | 5 | 116 | 1.22e-34 |
| vitvi_pan_p022438 | orthology | 1 | 3 | 103 | 1.05e-29 |
| vitvi_pan_p032656 | orthology | 1 | 3 | - | - |