Gene Solyc04g007630.1.1


Sequence ID Solyc04g007630.1.1  add to my list
Species Solanum lycopersicum
Alias No gene alias
Length 147aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 147 amino acids

>Solyc04g007630.1.1_SOLLC
MGIIDHISDMFEVTSTRKSKRKPMQTVEIKVKMDCDGCERKVTNAVSSIKGVKSVDVSRK
QSKVTVSGYIEPKKVLKRVQNTGKKAEFWPYVEYNLVSYPYAIGAYDKKAPSGYVRDVPQ
AFQTPNTPTQRLTSMFSDENPNACQIM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463678 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Solyc04g007630.1.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
AUR62014197-RA orthology 0.483 5 220.7 1e-57
AUR62024872-RA orthology 0.653 6 - -
AUR62030676-RA orthology 0.625 6 - -
Bv2_043150_njdu.t1 orthology 0.583 5 - -
Bv6_142690_rfcx.t1 orthology 0.841 6 - -
Ca_9_830.1 orthology 0.522 8 - -
Cc11_g08870 orthology 0.522 8 213 1.2e-55
DCAR_007285 orthology 0.469 8 219.2 2e-57
DCAR_023613 orthology 0.513 8 - -
DCAR_026769 orthology 0.484 8 - -
HanXRQChr08g0212651 orthology 0.468 6 231.9 4.2e-61
Oeu036720.1 orthology 0.339 4 - -
Oeu044351.1 orthology 0.321 4 233.8 1.1e-61
PGSC0003DMP400010633 orthology 0.0075 1 297 7.1e-81
capan_pan_p011898 orthology 0.127 2 - -
capan_pan_p025493 orthology 0.0685 2 283 6.68e-100
capan_pan_p030603 orthology 0.137 2 - -
ipotf_pan_p001332 orthology 0.483 4 - -
ipotf_pan_p026205 orthology 0.488 4 - -
ipotf_pan_p028506 orthology 0.344 4 227 8.17e-77
itb04g14310.t1 orthology 0.461 4 - -
itb07g07120.t1 orthology 0.337 4 231.1 5.2e-61
itb14g01060.t2 orthology 0.488 4 - -