Gene Solyc06g008950.1.1
| Sequence ID | Solyc06g008950.1.1 add to my list |
|---|---|
| Species | Solanum lycopersicum |
| Alias | No gene alias |
| Length | 149aa |
Length: 149 amino acids
>Solyc06g008950.1.1_SOLLC MKMMEVLHSVRGVYALTIDAEKGIANVCGEVDPNRLLLALLKSGQHAELINVKLKHPSIV NTPRNQHGHYNVGHGYNNNSNSLDGPYGYNHALNEPTSYYPTRGGAMFDQPYYGSTYYNS SPCVGYESNRSLTMDHVIKEEPMNWCSIM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP241299 | Unannotated cluster |
| 3 | GP128139 | Unannotated cluster |
| 4 | GP139101 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| capan_pan_p030823 | orthology | 0.291 | 1 | 162 | 5.31e-52 |
| medtr_pan_p007037 | orthology | 1 | 2 | - | - |