Gene Solyc06g050710.2.1


Sequence ID Solyc06g050710.2.1  add to my list
Species Solanum lycopersicum
Alias No gene alias
Length 73aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 73 amino acids

>Solyc06g050710.2.1_SOLLC
MANVVELKVGLHCDECIKKILKTIKKIEDIETYDVDKQLNKVTVTGNVTNEEVIKVLHKI
GKQASNWDQQSSC




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP240412 Unannotated cluster
3 GP342479 Unannotated cluster
4 GP464531 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Solyc06g050710.2.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Cc02_g05820 orthology 0.257 5 129.4 8.4e-31
DCAR_024797 orthology 0.555 4 109.8 8.5e-25
HanXRQChr08g0222621 orthology 0.343 4 120.2 9e-28
HanXRQChr15g0493871 orthology 0.39 4 - -
PGSC0003DMP400041420 orthology 0.037 2 143.7 5e-35
capan_pan_p032441 orthology 0.116 4 128 5.82e-41
ipotf_pan_p010921 orthology 0.286 2 121 3.07e-38
ipotf_pan_p028107 orthology 0.286 2 - -
itb12g24140.t1 orthology 0.286 2 118.6 1.9e-27