Gene Solyc06g072700.2.1
Sequence ID | Solyc06g072700.2.1 add to my list | ||
---|---|---|---|
Species | Solanum lycopersicum | ||
Alias | No gene alias | ||
Length | 344aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 344 amino acids
>Solyc06g072700.2.1_SOLLC MGEEEKKVEEVKKEEAPKDEKPSDGGGGEEKKEEKKAEEESKEAKPEPPPPPPPEIVLRV FMHCEGCARKVRKSLKGFQGVEDVLTDCKTHKVVVKGEKADPLKVLERIQKKSHRQVELL SPIPKPPEPAAEEPKKPEEKEAVKPDEKKEEPQVITVVLKVHMHCEACAQEIKRRIQKMK GVENAEPDLKNSQVTVKGVFEATKLVEYVSKRTGKRAVIVKVEPEKKAEEEAKPKEDQKE EKKTDEKEAKKVEGDDKEEKKEEAAAAAPAKEEAVVAAAPAKEEAVQNDVDPIVDVKKNE FYYYHHPQNHQLYNNPQRLAHEMFAYPPPPQIFSDENPNACSVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Solyc06g072700.2.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
PGSC0003DMP400046761 | orthology | 0.0301 | 1 | 287.3 | 1.3e-77 |
capan_pan_p009765 | orthology | 0.099 | 2 | 347 | 3.49e-119 |
capan_pan_p035442 | orthology | 0.13 | 2 | - | - |
ipotf_pan_p012033 | orthology | 0.451 | 4 | - | - |
ipotf_pan_p015819 | orthology | 0.463 | 4 | 267 | 7.52e-88 |
itb02g17790.t1 | orthology | 0.439 | 4 | - | - |
itb11g13550.t1 | orthology | 0.483 | 4 | 220.7 | 1.6e-57 |