Gene Solyc06g073070.1.1
Sequence ID | Solyc06g073070.1.1 add to my list | ||
---|---|---|---|
Species | Solanum lycopersicum | ||
Alias | No gene alias | ||
Length | 215aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 215 amino acids
>Solyc06g073070.1.1_SOLLC MSKEAKKELVKEPKIEEEKTEELKQHSPLILCIDLHCLGCAKKIERTISKIRGVDRVMID MEQNQVTISGVIEPQAVCASIVKETKRTAKVFSPLPLADEPIPGVVASQVNRLTTVELIV NMHCEACAKQLKRKILKMRGVRTAETDLTSGKVIVTGSIDANKLVDYVYRRTKSRPKLYF NMNRGSIRKNKIQMKKLRNSKKETKHQEEKKPSIR
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP126431 | Unannotated cluster |
4 | GP077890 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Solyc06g073070.1.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
HanXRQChr14g0448911 | orthology | 1 | 3 | - | - |
PGSC0003DMP400046920 | orthology | 0.47 | 3 | - | - |
capan_pan_p006811 | orthology | 0.374 | 2 | - | - |