Gene Solyc08g078730.2.1
Sequence ID | Solyc08g078730.2.1 add to my list | ||
---|---|---|---|
Species | Solanum lycopersicum | ||
Alias | No gene alias | ||
Length | 109aa | ||
Gene Ontology |
![]()
|
Length: 109 amino acids
>Solyc08g078730.2.1_SOLLC MEKSKCQKQTLFSVANLKLPSVVVVNADLGCTHCRSRISQIMSRITGMREYTIDVGKKQV IVRGDVRNHHQKKNGAVKNHKINEHHSRIFAFFFSLLNFHWSTSKKMTD
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP022701 | Unannotated cluster |
3 | GP047979 | Unannotated cluster |
4 | GP468909 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Solyc08g078730.2.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
vitvi_pan_p029133 | orthology | 1 | 1 | 70.5 | 4.01e-17 |