Gene Solyc10g085910.1.1
| Sequence ID | Solyc10g085910.1.1 add to my list | ||
|---|---|---|---|
| Species | Solanum lycopersicum | ||
| Alias | No gene alias | ||
| Length | 297aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 297 amino acids
>Solyc10g085910.1.1_SOLLC MKDMFCASQAATAICLSMEELGSSSSSSSVIQLGGGSISGSRTIDRYNPIIRDSRRTGPK SISAPCSARSPIPPKPHSKSRKSTSKESKRSKKLLIEKDDEKRKSSVSEGNENIFKTSSW SCKKPGEFITPPGSSRYLLSEKNILDALSDFEPVLKLVDSSSSSSVAEDVKTETDQSCPP PSASANQVVVLRVSLHCRGCEKKMRKHISRMQGVKSFNIDFAAKKVTVTGDVTPLGVLAS ISKVKNAQLWTPTLASAVPTAKVNLSNSELKNNDKQMVLSHEKIENVTPTTTTIQLM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP040905 | Unannotated cluster |
| 4 | GP469447 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Solyc10g085910.1.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| AUR62010447-RA | orthology | 0.955 | 5 | - | - |
| AUR62030468-RA | orthology | 0.767 | 5 | 159.1 | 7.4e-39 |
| Bv5_103030_anmg.t1 | orthology | 0.848 | 5 | 176.4 | 2.4e-44 |
| PGSC0003DMP400030742 | orthology | 0.0247 | 1 | 496.5 | 1.2e-140 |
| capan_pan_p021656 | orthology | 0.106 | 2 | 451 | 1.14e-161 |
| ipotf_pan_p006474 | orthology | 0.721 | 5 | 187 | 7.72e-58 |
| itb09g27700.t1 | orthology | 0.718 | 5 | 187.2 | 1.7e-47 |