Gene Solyc11g007200.1.1


Sequence ID Solyc11g007200.1.1  add to my list
Species Solanum lycopersicum
Alias No gene alias
Length 113aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 113 amino acids

>Solyc11g007200.1.1_SOLLC
MSQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVIGNVEPEAVFQTVSKT
GKKTSYWEEPAPASAPEPETKPVEEKPVEEKPTETPAEPEPKPTEEKPAETVA




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP239638 Unannotated cluster
3 GP341755 Unannotated cluster
4 GP463817 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Solyc11g007200.1.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_453_87.10 orthology 0.333 4 132.1 5.9e-31
Cc00_g29460 orthology 0.358 4 - -
Cc02_g09880 orthology 0.299 3 132.1 2e-31
PGSC0003DMP400033854 orthology 0.0765 1 140.2 8.6e-34
capan_pan_p004624 orthology 0.138 2 132 1.01e-41