Gene Solyc11g012690.1.1


Sequence ID Solyc11g012690.1.1  add to my list
Species Solanum lycopersicum
Alias No gene alias
Length 219aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 219 amino acids

>Solyc11g012690.1.1_SOLLC
MVLKVDLHCEGCARKVARALKGLQEIDEVTIDYEESKVVVKGKNVDPLKVCERVERKSGR
KVELISHMTKPFEENTKEEEIKKEEEKKDEPPPEITLVLNVQMHCDACAQVLQKQIRKIK
GVECVTTDIEKSQVIIKGFNIDPEKLTKEVNKRSGKQASLVNNIIQEKEEEEEKEEEKEE
YIIKDYNLAQKYYNNNMEYYANYSPQIFSDNNPNACSIM





Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323
Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015545
Heavy metal transport/detoxification group1
3 GP040674 Unannotated cluster
4 GP070448 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121
Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163
Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Solyc11g012690.1.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Ca_14_162.1 orthology 0.72 5 - -
Ca_32_762.1 orthology 0.784 5 - -
Ca_69_1.19 orthology 0.784 5 - -
Ca_78_26.1 orthology 0.72 5 - -
Ca_9_645.2 orthology 0.779 4 - -
Cc09_g00430 orthology 0.779 5 - -
Cg2g046420.1 orthology 0.851 11 - -
Cm145580.1 orthology 1 10 - -
Cm298860.1 orthology 0.857 10 - -
Cs2g01750.1 orthology 0.851 11 - -
DCAR_002239 orthology 0.727 7 - -
DCAR_030843 orthology 0.769 7 - -
FvH4_3g00420.1 orthology 0.815 11 - -
HanXRQChr16g0515801 orthology 0.87 7 - -
MELO3C008010.2.1 orthology 0.958 10 - -
Manes.09G082500.1 orthology 1 10 - -
Manes.S022000.1 orthology 0.778 10 - -
Oeu029318.1 orthology 0.652 6 - -
Oeu057024.1 orthology 0.691 6 - -
PGSC0003DMP400023518 orthology 0.168 1 280.8 7.9e-76
cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 orthology 0.826 9 - -
cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 orthology 0.763 9 - -
capan_pan_p018045 orthology 0.277 2 209 4.5e-69
cicar_pan_p024449 orthology 0.783 8 - -
cucsa_pan_p011686 orthology 0.946 10 - -
ipotf_pan_p000797 orthology 0.548 4 - -
itb01g10210.t2 orthology 0.554 4 - -
maldo_pan_p012376 orthology 0.828 11 - -
maldo_pan_p020510 orthology 0.837 11 - -
medtr_pan_p010658 orthology 0.769 8 - -
phavu.G19833.gnm2.ann1.Phvul.003G086400.1 orthology 0.777 9 - -
phavu.G19833.gnm2.ann1.Phvul.006G139700.1 orthology 0.814 9 - -
soybn_pan_p008938 orthology 0.758 8 - -
soybn_pan_p009673 orthology 0.79 8 - -
soybn_pan_p024238 orthology 0.771 8 - -
thecc_pan_p018912 orthology 0.746 10 - -
vitvi_pan_p012828 orthology 0.806 9 - -