Gene Solyc11g012690.1.1
Sequence ID | Solyc11g012690.1.1 add to my list | ||
---|---|---|---|
Species | Solanum lycopersicum | ||
Alias | No gene alias | ||
Length | 219aa | ||
Gene Ontology |
![]()
|
Length: 219 amino acids
>Solyc11g012690.1.1_SOLLC MVLKVDLHCEGCARKVARALKGLQEIDEVTIDYEESKVVVKGKNVDPLKVCERVERKSGR KVELISHMTKPFEENTKEEEIKKEEEKKDEPPPEITLVLNVQMHCDACAQVLQKQIRKIK GVECVTTDIEKSQVIIKGFNIDPEKLTKEVNKRSGKQASLVNNIIQEKEEEEEKEEEKEE YIIKDYNLAQKYYNNNMEYYANYSPQIFSDNNPNACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Solyc11g012690.1.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_14_162.1 | orthology | 0.72 | 5 | - | - |
Ca_32_762.1 | orthology | 0.784 | 5 | - | - |
Ca_69_1.19 | orthology | 0.784 | 5 | - | - |
Ca_78_26.1 | orthology | 0.72 | 5 | - | - |
Ca_9_645.2 | orthology | 0.779 | 4 | - | - |
Cc09_g00430 | orthology | 0.779 | 5 | - | - |
Cg2g046420.1 | orthology | 0.851 | 11 | - | - |
Cm145580.1 | orthology | 1 | 10 | - | - |
Cm298860.1 | orthology | 0.857 | 10 | - | - |
Cs2g01750.1 | orthology | 0.851 | 11 | - | - |
DCAR_002239 | orthology | 0.727 | 7 | - | - |
DCAR_030843 | orthology | 0.769 | 7 | - | - |
FvH4_3g00420.1 | orthology | 0.815 | 11 | - | - |
HanXRQChr16g0515801 | orthology | 0.87 | 7 | - | - |
MELO3C008010.2.1 | orthology | 0.958 | 10 | - | - |
Manes.09G082500.1 | orthology | 1 | 10 | - | - |
Manes.S022000.1 | orthology | 0.778 | 10 | - | - |
Oeu029318.1 | orthology | 0.652 | 6 | - | - |
Oeu057024.1 | orthology | 0.691 | 6 | - | - |
PGSC0003DMP400023518 | orthology | 0.168 | 1 | 280.8 | 7.9e-76 |
cajca.ICPL87119.gnm1.ann1.C.cajan_16695.1 | orthology | 0.826 | 9 | - | - |
cajca.ICPL87119.gnm1.ann1.C.cajan_24624.1 | orthology | 0.763 | 9 | - | - |
capan_pan_p018045 | orthology | 0.277 | 2 | 209 | 4.5e-69 |
cicar_pan_p024449 | orthology | 0.783 | 8 | - | - |
cucsa_pan_p011686 | orthology | 0.946 | 10 | - | - |
ipotf_pan_p000797 | orthology | 0.548 | 4 | - | - |
itb01g10210.t2 | orthology | 0.554 | 4 | - | - |
maldo_pan_p012376 | orthology | 0.828 | 11 | - | - |
maldo_pan_p020510 | orthology | 0.837 | 11 | - | - |
medtr_pan_p010658 | orthology | 0.769 | 8 | - | - |
phavu.G19833.gnm2.ann1.Phvul.003G086400.1 | orthology | 0.777 | 9 | - | - |
phavu.G19833.gnm2.ann1.Phvul.006G139700.1 | orthology | 0.814 | 9 | - | - |
soybn_pan_p008938 | orthology | 0.758 | 8 | - | - |
soybn_pan_p009673 | orthology | 0.79 | 8 | - | - |
soybn_pan_p024238 | orthology | 0.771 | 8 | - | - |
thecc_pan_p018912 | orthology | 0.746 | 10 | - | - |
vitvi_pan_p012828 | orthology | 0.806 | 9 | - | - |