Gene Solyc11g073020.1.1
Sequence ID | Solyc11g073020.1.1 add to my list | ||
---|---|---|---|
Species | Solanum lycopersicum | ||
Alias | No gene alias | ||
Length | 258aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 258 amino acids
>Solyc11g073020.1.1_SOLLC MKSIDIFCASPASTAICSSMDQYTMVRRGIRHQIDRKIDRLGDPRTPKIKTPIPCSSNQL PFDPKTYYHQNKNRKSHDEKLRRKSSADVTDLGNSSRYLLSDHSTNTPFIDFLSSSGDAS KALVPTKPLRAKSTNERLMYRSSSLESPVYKPSSAYSNDLCVYKSTRSCPSEQVVELRVS IHCKGCEGKVRKHISRMEGVKSFNIDLASKKVTVIGDVTPLGVLTSVSKVKNAQFWPFPT TSSSSSSSSSSSWSSPII
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Solyc11g073020.1.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Ca_4_477.7 | orthology | 0.539 | 5 | - | - |
Ca_84_91.1 | orthology | 0.529 | 6 | 211.8 | 1.3e-54 |
Cc01_g12180 | orthology | 0.528 | 6 | 211.5 | 5.9e-55 |
Oeu040283.1 | orthology | 0.481 | 3 | - | - |
Oeu058521.1 | orthology | 0.415 | 3 | 220.7 | 1.7e-57 |
PGSC0003DMP400027269 | orthology | 0.0284 | 1 | 453.8 | 8e-128 |
capan_pan_p010270 | orthology | 0.0811 | 2 | 358 | 3.18e-126 |
ipotf_pan_p019321 | orthology | 0.816 | 6 | - | - |
ipotf_pan_p020149 | orthology | 0.695 | 6 | 219 | 4.18e-71 |
itb07g12040.t1 | orthology | 0.8 | 6 | - | - |
itb14g16600.t1 | orthology | 0.68 | 6 | 218.4 | 6.1e-57 |