Gene Sspon.01G0001200-1P
| Sequence ID | Sspon.01G0001200-1P add to my list |
|---|---|
| Species | Saccharum spontaneum |
| Alias | No gene alias |
| Length | 98aa |
Length: 98 amino acids
>Sspon.01G0001200-1P_SACSP MEKVTVTGYVDRARVLQEVRRSGKKAEFWPSRGTPLWFTSPRSYFRDDGGSYRRDSYNYR RHGYSDGDRHGRMREPARGDGPVGNMFNDDDVNAACRI
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| sorbi_pan_p025667 | orthology | 0.0512 | 1 | 184 | 6.14e-61 |