Gene Sspon.01G0018770-1A
| Sequence ID | Sspon.01G0018770-1A add to my list | ||
|---|---|---|---|
| Species | Saccharum spontaneum | ||
| Alias | No gene alias | ||
| Length | 121aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 121 amino acids
>Sspon.01G0018770-1A_SACSP MAPVILSMDVHCHGCAKKIQKAVMKLPGVDSVTFGTGLLMIEGTADAAVLRSQLQDKTGK AVNVVSNGVEDGEAASGSGGCFSGNASPPPRAPIILEMKLHCRSCSKKVEKRVMQIPGTN K
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
| 3 | GP126431 | Unannotated cluster |
| 4 | GP077890 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Sspon.01G0018770-1A
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Sspon.01G0018770-2D | ultra-paralogy | 0.117 | 0 | - | - |
| Sspon.03G0027780-1B | ultra-paralogy | 1 | 0 | - | - |