Gene Sspon.01G0031200-1A


Sequence ID Sspon.01G0031200-1A  add to my list
Species Saccharum spontaneum
Alias No gene alias
Length 210aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 210 amino acids

>Sspon.01G0031200-1A_SACSP
MAPLLFRDMKGLSCSSPASTAICPSLERQPMVRSHKAIASPSPSPLAHVPPEPRTHRHDG
KKGQQQQQQQHKAVVLPNNTGGFVSPAGSSRYLLSSGRFAATVTEEIQEVVESAPAVDAK
REEASEAADAKSGAQAQEQVVVLKVSLHCKACAGKVKKHLSKMEGVTSFNIDFAAKKVTV
VGDVTPLGVLNSVSKVKNAQLWAAPPAIAA




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP015837 Unannotated cluster
3 GP040905 Unannotated cluster
4 GP070656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Sspon.01G0031200-1A



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Sspon.01G0031200-1P ultra-paralogy 0.0015 0 - -
Sspon.01G0031200-2B ultra-paralogy 0.0023 0 - -
Sspon.01G0031200-3D ultra-paralogy 0.0114 0 - -
maize_pan_p014397 orthology 0.387 2 - -
maize_pan_p019962 orthology 0.108 2 303 6.38e-106
maize_pan_p032298 orthology 0.202 2 - -
maize_pan_p043327 orthology 0.361 2 - -
sorbi_pan_p010670 orthology 0.0325 1 - -