Gene Sspon.01G0031200-2B
Sequence ID | Sspon.01G0031200-2B add to my list | ||
---|---|---|---|
Species | Saccharum spontaneum | ||
Alias | No gene alias | ||
Length | 207aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 207 amino acids
>Sspon.01G0031200-2B_SACSP MAPLLFRDMKGLSCSSPASTAICPSLERQPMVRSHKAIASPSPSPLAHVPPEPRTHRHDG KKGQQQQHKAVVLPNNTGGFVSPAGSSRYLLSSGRFAATVTEEIQEVVESAPAVDAKREE ASEAADAKSGAQAQEQVVVLKVSLHCKACAGKVKKHLSKMEGVTSFNIDFAAKKVTVVGD VTPLGVLNSVSKVKNAQLWAAPPAIAA
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Sspon.01G0031200-2B
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Sspon.01G0031200-1A | ultra-paralogy | 0.0023 | 0 | - | - |
Sspon.01G0031200-1P | ultra-paralogy | 0.0028 | 0 | - | - |
Sspon.01G0031200-3D | ultra-paralogy | 0.0102 | 0 | - | - |
maize_pan_p014397 | orthology | 0.386 | 2 | - | - |
maize_pan_p019962 | orthology | 0.106 | 2 | - | - |
maize_pan_p032298 | orthology | 0.201 | 2 | - | - |
maize_pan_p043327 | orthology | 0.36 | 2 | - | - |
sorbi_pan_p010670 | orthology | 0.0313 | 1 | - | - |