Gene Sspon.01G0033670-1A
| Sequence ID | Sspon.01G0033670-1A add to my list |
|---|---|
| Species | Saccharum spontaneum |
| Alias | No gene alias |
| Length | 117aa |
Length: 117 amino acids
>Sspon.01G0033670-1A_SACSP MDAKALPDILSAKLNRRVTAVVVPPTTNKNKDKKAAAGPGDNHDDNREQGEEAAGGGGGI LLVAPRRRTRIGSSSSEERPQLKPAVTTTTRWLLGCRRSSGTRTRRYSRRRTEEEDQ
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP015837 | Unannotated cluster |
| 3 | GP358710 | Unannotated cluster |
| 4 | GP490066 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Sspon.01G0033670-2D | ultra-paralogy | 0.398 | 0 | - | - |
| sorbi_pan_p022833 | orthology | 0.523 | 1 | - | - |