Gene Sspon.01G0050820-1C


Sequence ID Sspon.01G0050820-1C  add to my list
Species Saccharum spontaneum
Alias No gene alias
Length 156aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 156 amino acids

>Sspon.01G0050820-1C_SACSP
MLRVDDLIGELCLRPAKVLGKKKRKEFQTVELLVRMDCEGCERRVRKALEDMKGVSSVEV
DPKENKVSVSGYVEAPEVMERLRRRAGKEAQPWPYVPYEVVPHPYAPGAYDKKAPPGYVR
NVLDDPDAAPLVRASSMEERYTTAFSDDNPNSCAVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Sspon.01G0050820-1C



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Sspon.01G0050820-2D ultra-paralogy 0.0073 0 - -
XP_008807137.1 orthology 0.58 4 - -
XP_008809430.1 orthology 0.529 4 229.2 3e-60
XP_010920102.1 orthology 0.541 5 - -
XP_010933357.1 orthology 0.531 5 - -
cocnu_pan_p018212 orthology 0.527 5 - -
cocnu_pan_p019869 orthology 0.509 5 - -
cocnu_pan_p033502 orthology 0.539 5 - -
maize_pan_p031380 orthology 0.0895 1 - -
sorbi_pan_p009526 orthology 0.062 2 - -