Gene Sspon.01G0050820-2D


Sequence ID Sspon.01G0050820-2D  add to my list
Species Saccharum spontaneum
Alias No gene alias
Length 155aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 155 amino acids

>Sspon.01G0050820-2D_SACSP
MLRVDDLIGELCLLPAKVLGKKKRKEFQTVELLVRMDCEGCERRVRKALEDMKGVSSVEV
DPKENKVSVSGYVEAPEVMERLRRRAGKEAQPWPYVPYEVVPHPYAPGAYDKKAPPGYVR
NVLDDPDAAPLVRASSMEERYTTAFSDDNPNSCAV




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP040065 Unannotated cluster
4 GP463617 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Sspon.01G0050820-2D



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Sspon.01G0050820-1C ultra-paralogy 0.0073 0 - -
XP_008807137.1 orthology 0.574 4 - -
XP_008809430.1 orthology 0.522 4 228 4.9e-78
XP_010920102.1 orthology 0.535 5 - -
XP_010933357.1 orthology 0.524 5 - -
cocnu_pan_p018212 orthology 0.521 5 - -
cocnu_pan_p019869 orthology 0.502 5 - -
cocnu_pan_p033502 orthology 0.533 5 - -
maize_pan_p031380 orthology 0.0832 1 293 1.07e-103
sorbi_pan_p009526 orthology 0.0558 2 302 1.97e-107