Gene Sspon.03G0007600-4D
Sequence ID | Sspon.03G0007600-4D add to my list | ||
---|---|---|---|
Species | Saccharum spontaneum | ||
Alias | No gene alias | ||
Length | 142aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 142 amino acids
>Sspon.03G0007600-4D_SACSP MGRTARLGLDKVLDCFSLSLCSNACACIHSVEEEDEDEANERKALVSSQLQELVKLRDFV DGAAKTLAFHLEPKTVELKVSMHCYGCAKKVQKHISKMDGVTSFEVDLENKKVVVIGDIT PYEVLESISKVKFAELWVAPQL
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP015837 | Unannotated cluster |
3 | GP040905 | Unannotated cluster |
4 | GP070656 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Sspon.03G0007600-4D
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
ORGLA01G0238900.1 | orthology | 0.254 | 4 | - | - |
maize_pan_p020184 | orthology | 0.18 | 2 | - | - |
maize_pan_p030082 | orthology | 0.273 | 2 | - | - |
maize_pan_p032385 | orthology | 0.375 | 2 | - | - |
maize_pan_p044072 | orthology | 0.178 | 2 | - | - |
orysa_pan_p027804 | orthology | 0.247 | 4 | - | - |
sorbi_pan_p023239 | orthology | 0.0429 | 1 | - | - |