Gene Sspon.03G0027420-1B
Sequence ID | Sspon.03G0027420-1B add to my list | ||
---|---|---|---|
Species | Saccharum spontaneum | ||
Alias | No gene alias | ||
Length | 206aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 206 amino acids
>Sspon.03G0027420-1B_SACSP MASEAIECQDVVLRVPIHCQGCKKKVKKVLQNISGVYRCEIDARSNKVVAKVSTKLDPYM LVAKLRKSGKQAELWPEQPVQHQAPPSPAAESQTQEPKNNQPDEPTKPNEPAEKRGADTA DDAAAEPSNPPETKQSTGEAPNPAQDSKENASANVAGNDTAMAPAQHGPSEAKGKAKAMQ QPEMEERQPVDARVTVEYDRCRRRQS
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Sspon.03G0027420-1B
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
AUR62008611-RA | orthology | 1 | 5 | - | - |
Bv7_164120_fciq.t1 | orthology | 1 | 5 | - | - |
Sspon.03G0027420-2C | ultra-paralogy | 0.0898 | 0 | - | - |
Sspon.03G0027420-3D | ultra-paralogy | 0.0911 | 0 | - | - |
evm_27.model.AmTr_v1.0_scaffold00016.303 | orthology | 1 | 3 | - | - |
maize_pan_p027253 | orthology | 0.164 | 1 | - | - |
sorbi_pan_p013497 | orthology | 0.141 | 2 | - | - |