Gene Sspon.03G0027790-1B


Sequence ID Sspon.03G0027790-1B  add to my list
Species Saccharum spontaneum
Alias No gene alias
Length 108aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 108 amino acids

>Sspon.03G0027790-1B_SACSP
MKLMKRNCWNNAQVQVVVMSANMGCSHCRQRVANVVSKMNGLLDYMVDFGKKEVTVRGKV
EHTKKKKKHRKTLLGAAGWDDDARSAAASSPGGGQARTLSWFLGCYGS




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP022701 Unannotated cluster
3 GP047979 Unannotated cluster
4 GP471861 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily
Heavy-metal-associated, conserved site
IPR017969 		Heavy-metal-associated, conserved site Conserved_site

IPR006121 IPR036163 IPR017969
Figure 1: IPR domains for Sspon.03G0027790-1B



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Sspon.03G0027790-2C ultra-paralogy 0.001 0 - -
maize_pan_p010927 orthology 0.186 2 - -
musac_pan_p022732 orthology 0.928 3 - -
sorbi_pan_p018268 orthology 0.152 1 111 7.94e-33