Gene Sspon.03G0027790-2C
Sequence ID | Sspon.03G0027790-2C add to my list |
---|---|
Species | Saccharum spontaneum |
Alias | No gene alias |
Length | 64aa |
Length: 64 amino acids
>Sspon.03G0027790-2C_SACSP MVDFGKKEVTVRGKVEHTKKKKKKHRKTLLGAAGWDDDARSAAASSPGGGQARTLSWFLG CYGS
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP022701 | Unannotated cluster |
3 | GP047979 | Unannotated cluster |
4 | GP471861 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Sspon.03G0027790-1B | ultra-paralogy | 0.001 | 0 | - | - |
maize_pan_p010927 | orthology | 0.186 | 2 | - | - |
musac_pan_p022732 | orthology | 0.928 | 3 | - | - |
sorbi_pan_p018268 | orthology | 0.152 | 1 | - | - |