Gene Sspon.03G0031090-2C
| Sequence ID | Sspon.03G0031090-2C add to my list | ||
|---|---|---|---|
| Species | Saccharum spontaneum | ||
| Alias | No gene alias | ||
| Length | 161aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 161 amino acids
>Sspon.03G0031090-2C_SACSP MDCPGCEKKIRKAVQRLEGVHDVEIDMAQQKVTVNGDVEQKKVLKAVRRTGRRAVLWPLP YAAGAAAGAGAAHVLAQQQLMYQPGAAGLAAHASHAARPTSSYNYYKHGYDDSRMYGAYY HHGANSAVAGTRTTDYFSDENAQGCSVIPTISTSTMANALT
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Sspon.03G0031090-2C
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Mba03_g16740.1 | orthology | 0.499 | 3 | - | - |
| Sspon.03G0031090-1B | ultra-paralogy | 0.001 | 0 | - | - |
| XP_008813766.1 | orthology | 0.61 | 4 | 151.8 | 6.3e-37 |
| XP_010920018.1 | orthology | 0.623 | 5 | 152.1 | 5.1e-37 |
| cocnu_pan_p020915 | orthology | 0.631 | 5 | - | - |
| musac_pan_p001588 | orthology | 0.519 | 3 | 145 | 1.68e-45 |
| sorbi_pan_p007128 | orthology | 0.0249 | 1 | - | - |