Gene Sspon.04G0008560-1A
| Sequence ID | Sspon.04G0008560-1A add to my list |
|---|---|
| Species | Saccharum spontaneum |
| Alias | No gene alias |
| Length | 91aa |
Length: 91 amino acids
>Sspon.04G0008560-1A_SACSP MATKYIIGSVAASFAFAYVCGVYVADRKVLGGEVPIRLSALMALDITAALSAGTTPRTET DKKFQAWPRTAGPPVAMNPIRRHNFIVKSSE
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Unknown function duf1138 family
GP002478 |
Unknown function duf1138 family |
| 2 | GP018276 | Unannotated cluster |
| 3 | GP042981 | Unannotated cluster |
| 4 | GP072479 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Protein of unknown function DUF1138
IPR009515
|
Protein of unknown function DUF1138 | Family |
Figure 1: IPR domains for Sspon.04G0008560-1A
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| PGSC0003DMP400040975 | orthology | 0.304 | 1 | - | - |
| Solyc10g080190.1.1 | orthology | 0.29 | 2 | - | - |
| capan_pan_p022960 | orthology | 0.537 | 3 | - | - |
| capan_pan_p035797 | orthology | 0.343 | 3 | - | - |