Gene Sspon.04G0023540-1B
| Sequence ID | Sspon.04G0023540-1B add to my list |
|---|---|
| Species | Saccharum spontaneum |
| Alias | No gene alias |
| Length | 294aa |
Length: 294 amino acids
>Sspon.04G0023540-1B_SACSP MQPAWATENDRTRAKNLIHYLEPAGDTTLFFPPHVEAFPANRYPSPEQYLFVAHRRIYPR PTDGRSLFGIRELHAIGVALVQLTVSIGLLSANRGSIYTLRPCAPPPPMPIEPDRRLCST VPEKCCAFGGRRGAPPRRTRLNRFVIVNEKEDGIVSVASVDVRFACVFCGQDRGDERAHG LRRLREARVSSVEIDMDRQKVTVTGYVDRREVLRAARRTGRAAEFWPWPYDGEYYPFAIQ YLEDNTYMATDRYYRHGYNDPMIGSYPCHAFTHVLDDDALAVFHDDNVHACAVM
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
No IPR domain.
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Dr00501 | orthology | 1 | 4 | 164.1 | 1.2e-40 |
| Mba02_g11510.1 | orthology | 1 | 4 | 156 | 4.1e-38 |
| Sspon.04G0006170-1A | ultra-paralogy | 0.114 | 0 | - | - |
| XP_008783549.1 | orthology | 1 | 6 | 160.6 | 2.5e-39 |
| XP_010934033.1 | orthology | 0.965 | 6 | 162.5 | 6.9e-40 |
| cocnu_pan_p034578 | orthology | 1 | 5 | 163 | 1.11e-50 |
| maize_pan_p014734 | orthology | 0.186 | 1 | - | - |
| musac_pan_p001552 | orthology | 1 | 4 | 152 | 5.78e-46 |