Gene Sspon.05G0023740-1B


Sequence ID Sspon.05G0023740-1B  add to my list
Species Saccharum spontaneum
Alias No gene alias
Length 120aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 120 amino acids

>Sspon.05G0023740-1B_SACSP
MQIVLAGRKIEAQYVEMKVPLYSYGCEKKIKKALSHLKGIHSVQVDYHQQKVTVWGICNR
DDVLAAVRKKRRDARFWNSDELGPGEHVPPPGEAPKQYLAAFTAYRLRKSWKKLFPLIRL




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2
Heavy metal transport/detoxification group1
GP015397		 Heavy metal transport/detoxification group1
3 GP342521 Unannotated cluster
4 GP467872 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for Sspon.05G0023740-1B



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Mba04_g24060.1 orthology 0.515 4 - -
XP_008808278.1 orthology 0.602 4 - -
XP_010919018.1 orthology 0.609 5 - -
XP_010934032.1 orthology 0.567 4 - -
cocnu_pan_p020678 orthology 0.583 4 - -
cocnu_pan_p024529 orthology 0.656 5 - -
musac_pan_p009117 orthology 0.53 4 - -
sorbi_pan_p001968 orthology 0.0183 1 - -