Gene Sspon.05G0023740-2D
| Sequence ID | Sspon.05G0023740-2D add to my list | ||
|---|---|---|---|
| Species | Saccharum spontaneum | ||
| Alias | No gene alias | ||
| Length | 123aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 123 amino acids
>Sspon.05G0023740-2D_SACSP MADMQIVLAGRKIEAQYVEMKVPLYSYGCEKKIKKALSHLKGIHSVQVDYHQQKVTVWGI CNRDDVLAAVRKKRRDARFWNSDELGPGEHVPPPGEAPKQYLAAFTAYRLRKSWKKLFPL IRL
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP342521 | Unannotated cluster |
| 4 | GP467872 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Sspon.05G0023740-2D
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Mba04_g24060.1 | orthology | 0.515 | 5 | 162.2 | 2.4e-40 |
| Sspon.05G0023740-1P | orthology | 0 | 1 | - | - |
| XP_008808278.1 | orthology | 0.602 | 5 | 161.8 | 4.6e-40 |
| XP_010919018.1 | orthology | 0.609 | 6 | 163.3 | 1.7e-40 |
| XP_010934032.1 | orthology | 0.567 | 5 | - | - |
| cocnu_pan_p020678 | orthology | 0.583 | 5 | 159 | 7.07e-52 |
| cocnu_pan_p024529 | orthology | 0.656 | 6 | - | - |
| musac_pan_p009117 | orthology | 0.53 | 5 | 164 | 1.07e-53 |
| sorbi_pan_p001968 | orthology | 0.0183 | 2 | 248 | 5.98e-87 |