Gene Sspon.06G0001840-2C
| Sequence ID | Sspon.06G0001840-2C add to my list | ||
|---|---|---|---|
| Species | Saccharum spontaneum | ||
| Alias | No gene alias | ||
| Length | 103aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 103 amino acids
>Sspon.06G0001840-2C_SACSP MAITILCAFPDCWRSQSTELKVEMVALHEKRVRKCLSKVKGIERVEVEASLQKVVVTGCV NRSKILKALRRVGLRAEPWSPHNELLSAYATTTLMFNNSYAFF
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP040065 | Unannotated cluster |
| 4 | GP078604 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Sspon.06G0001840-2C
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| Ca_12_32.9 | orthology | 0.767 | 9 | - | - |
| Ca_3_262.11 | orthology | 0.767 | 9 | - | - |
| Ca_455_136.3 | orthology | 0.767 | 9 | - | - |
| Ca_68_16.11 | orthology | 0.79 | 9 | - | - |
| Cc10_g00290 | orthology | 0.79 | 9 | - | - |
| Cg3g025710.1 | orthology | 0.661 | 11 | - | - |
| Cm122260.1 | orthology | 0.673 | 10 | - | - |
| Cs3g27690.1 | orthology | 0.661 | 11 | - | - |
| DCAR_023025 | orthology | 0.651 | 6 | - | - |
| MELO3C017056.2.1 | orthology | 0.807 | 11 | 104.8 | 2.9e-23 |
| Manes.05G127500.1 | orthology | 0.7 | 9 | - | - |
| Manes.18G002200.1 | orthology | 0.713 | 9 | - | - |
| Mba08_g25790.1 | orthology | 0.399 | 3 | - | - |
| Oeu013567.1 | orthology | 0.671 | 7 | - | - |
| Sspon.06G0001840-3D | ultra-paralogy | 0.011 | 0 | - | - |
| XP_010932092.1 | orthology | 0.34 | 4 | - | - |
| XP_017697769.1 | orthology | 0.365 | 4 | - | - |
| XP_019707878.1 | orthology | 0.377 | 5 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_11445.1 | orthology | 0.816 | 7 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22304.1 | orthology | 0.814 | 7 | - | - |
| cajca.ICPL87119.gnm1.ann1.C.cajan_22894.1 | orthology | 0.812 | 6 | - | - |
| capan_pan_p037558 | orthology | 0.778 | 8 | 92 | 5.99e-26 |
| cicar_pan_p012771 | orthology | 0.934 | 8 | - | - |
| cocnu_pan_p024788 | orthology | 0.34 | 4 | - | - |
| cocnu_pan_p029661 | orthology | 0.403 | 5 | - | - |
| cucsa_pan_p017207 | orthology | 0.807 | 11 | 103 | 9.7e-31 |
| maldo_pan_p020708 | orthology | 0.697 | 9 | - | - |
| medtr_pan_p031498 | orthology | 0.867 | 8 | - | - |
| musac_pan_p036492 | orthology | 0.387 | 3 | - | - |
| phavu.G19833.gnm2.ann1.Phvul.002G208500.1 | orthology | 0.824 | 6 | 101.7 | 3e-22 |
| sorbi_pan_p020199 | orthology | 0.0424 | 1 | 169 | 2.29e-56 |
| soybn_pan_p018879 | orthology | 0.867 | 6 | - | - |
| soybn_pan_p037728 | orthology | 0.892 | 7 | - | - |
| soybn_pan_p037999 | orthology | 0.933 | 7 | - | - |
| soybn_pan_p041984 | orthology | 0.902 | 7 | - | - |
| thecc_pan_p004256 | orthology | 0.709 | 10 | - | - |
| vitvi_pan_p014910 | orthology | 0.623 | 8 | - | - |
| vitvi_pan_p031077 | orthology | 0.623 | 8 | - | - |