Gene Sspon.06G0021640-1B
| Sequence ID | Sspon.06G0021640-1B add to my list | ||
|---|---|---|---|
| Species | Saccharum spontaneum | ||
| Alias | No gene alias | ||
| Length | 123aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 123 amino acids
>Sspon.06G0021640-1B_SACSP MSGKVTTAVAKPTVLCCCDHELEQGVVTGVCFVTWVQQLYCMTVRMNIDCNGCYQRIRRA LLHMQDLESHLIDRKQHRVSVCGAFVPQDVAIKLRKRTNRRVEILEIKEVDAGAGGDGGQ QPS
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | GP109350 | Unannotated cluster |
| 3 | GP119142 | Unannotated cluster |
| 4 | GP077996 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for Sspon.06G0021640-1B
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| ORGLA08G0136300.1 | orthology | 0.283 | 2 | 147.1 | 7.7e-36 |
| bradi_pan_p016580 | orthology | 0.553 | 2 | - | - |
| musac_pan_p023320 | orthology | 0.757 | 3 | 125 | 7.83e-39 |
| orysa_pan_p036324 | orthology | 0.283 | 2 | 147 | 2.43e-47 |