Gene XP_008785647.1
Sequence ID | XP_008785647.1 add to my list | ||
---|---|---|---|
Species | Phoenix dactylifera | ||
Alias | No gene alias | ||
Length | 271aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 271 amino acids
>XP_008785647.1_PHODC MGEEQKEEEQKEQEEKKAEGAEENKEEEKKEEKKEEETPEVVLKVDMHCEGCAKKVERSL RRFEGIEDVKTDSRSRTVVVKGKGADPIKVCERIQKKTGKRVELISPLPRPSEEEKKEEP PQEEKKEEPKAITVVLKVRMHCDACAQVLQRRIKKMDGVESVATDLPNDQVIVKGMIDPV KLVENVYRRTRKQASIVQGEEKKEEEKKEEKKEEEKEEKGEGEKKEEKENGEDDKKIDVK KYEYWPLRYSVEYAYPPQIFSDENPNACTIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_008785647.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Dr07989 | orthology | 0.477 | 4 | 194.5 | 7.7e-50 |
Mba01_g01930.1 | orthology | 0.318 | 4 | 192.2 | 4.7e-49 |
ORGLA10G0044600.1 | orthology | 0.518 | 3 | 185.3 | 5.5e-47 |
XP_010939247.1 | orthology | 0.122 | 2 | 281.6 | 9.3e-76 |
cocnu_pan_p027064 | orthology | 0.0945 | 2 | 256 | 3.9e-87 |
musac_pan_p010117 | orthology | 0.298 | 4 | 260 | 2.86e-87 |
orysa_pan_p012537 | orthology | 0.518 | 3 | 216 | 6.67e-70 |