Gene XP_008798969.1
Sequence ID | XP_008798969.1 add to my list | ||
---|---|---|---|
Species | Phoenix dactylifera | ||
Alias | No gene alias | ||
Length | 338aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 338 amino acids
>XP_008798969.1_PHODC MGEEEKKPAEGKKEEKPKEKEEKMGDAKAEEGKKGGGGGGGGEGEKEGGGEEEKKGEAAP PPPPPEEIVMRVYMHCEGCSRKVKRCLQGFEGVEEVKTDCRNYKVVVKGKKAAEDPLKVV ERVQKKTGRKVELLTPLPPPKPEKEEEKKEEEKPKPEEKKEEPPVIAVVLKVHMHCEACS QEIKKSILKMKGVQAAEPDLKVSQVTVTGVLDPVKLVEYVYKRTGKHAVVVKQEPVEKKL DEEKKAADGKDGSKDEKKADAGGEKAEGEKKDEREGGGEEKEKEGGGGAAEHAAAGGAAK VVDLMKNEFCYYYPRYGVGYAYPPQIFSDENPNACTVM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP070448 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_008798969.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Mba06_g07140.1 | orthology | 0.213 | 3 | 228.4 | 7.5e-60 |
Mba09_g01180.1 | orthology | 0.3 | 3 | - | - |
XP_010913005.1 | orthology | 0.0732 | 2 | 253.8 | 2.6e-67 |
XP_019703519.1 | orthology | 0.0732 | 2 | 301 | 2.65e-101 |
cocnu_pan_p032228 | orthology | 0.0819 | 2 | - | - |
cocnu_pan_p033823 | orthology | 0.0598 | 2 | 315 | 1.37e-106 |
musac_pan_p001323 | orthology | 0.24 | 3 | - | - |
musac_pan_p006095 | orthology | 0.216 | 3 | 286 | 3.55e-95 |
musac_pan_p033691 | orthology | 0.511 | 2 | - | - |