Gene XP_008805754.1
Sequence ID | XP_008805754.1 add to my list | ||
---|---|---|---|
Species | Phoenix dactylifera | ||
Alias | No gene alias | ||
Length | 288aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 288 amino acids
>XP_008805754.1_PHODC MASAEEGPEPLKYQTLTLKVAIHCEGCKKKVKKVLQSIEGVYKTTIDSQQQKVVVTGNVE AETLIKKLVKTGKHAELWPEKKPNNPANNNSSSGGGKKNKNKNKASGKPNEQSENPDTNQ TPKASGDDSSPDSSAQHDDKAPKNSGKDCPKADKKEAGNSPPPEKQDGAAAASSGGGGKK KGKKGQKENKGAGGGGELQVVSEEMGGKASGDGGGGLPAFNYPVYPTSQPPAYMVSYSSV QPSASYGGAYYPMSMNQSSYFYSGATAATAPGSYYIFSDENANACRIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | GP023608 | Unannotated cluster |
3 | GP040483 | Unannotated cluster |
4 | GP070015 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_008805754.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Mba02_g04300.1 | orthology | 0.578 | 3 | - | - |
Mba09_g27230.1 | orthology | 0.617 | 3 | 147.1 | 1.9e-35 |
Mba11_g12300.1 | orthology | 0.539 | 3 | - | - |
XP_010914416.1 | orthology | 0.161 | 2 | - | - |
cocnu_pan_p023410 | orthology | 0.101 | 2 | - | - |
musac_pan_p013541 | orthology | 0.609 | 3 | - | - |
musac_pan_p014845 | orthology | 0.938 | 3 | - | - |
musac_pan_p029076 | orthology | 0.562 | 3 | - | - |
musac_pan_p032387 | orthology | 0.526 | 2 | - | - |