Gene XP_008808240.1
| Sequence ID | XP_008808240.1 add to my list | ||
|---|---|---|---|
| Species | Phoenix dactylifera | ||
| Alias | No gene alias | ||
| Length | 141aa | ||
| Gene Ontology |
 Display term(s) (1)
|
Length: 141 amino acids
>XP_008808240.1_PHODC MVDAGKPGPWSFRVLMAIVLELKVYMHCKACERLVLNTLRKFKGVETVNVDMNGDKAIVT GQIEPEKILKKLRKKTGKRVEIIKRNDDNAEGNKDETFPLSGDCNMQTMDGSVVLSDNFV ENVVPDFDMFSDENPNACSIT
| Clustering Level | Family ID | Family Name |
|---|---|---|
| 1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
| 2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
| 3 | GP345758 | Unannotated cluster |
| 4 | GP467256 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
| ID | Name | Type |
|---|---|---|
|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
|
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_008808240.1
| Homology | RBH | ||||
|---|---|---|---|---|---|
| Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
| XP_010942139.2 | orthology | 0.156 | 1 | 258.1 | 5.8e-69 |
| cocnu_pan_p012133 | orthology | 0.548 | 2 | 188 | 4.61e-60 |
| musac_pan_p016062 | orthology | 1 | 3 | 91.7 | 3.24e-25 |