Gene XP_008809313.1


Sequence ID XP_008809313.1  add to my list
Species Phoenix dactylifera
Alias No gene alias
Length 160aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 160 amino acids

>XP_008809313.1_PHODC
MRTAGMLCRSHASTAVCIPGDPRSMIVSRRADRTLVEHSRLVDLKYSRLMDSRRFMPREE
GRSVTLPMVLKKERAPPKPTNVSSSPPPSSGHVFQVVVMRVSIHCQGCAGKVRKHISKME
GVTSFSIDLESKRVTVMGHVSPVGVLESISKVKRAEFWPC




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP015837 Unannotated cluster
3 GP040905 Unannotated cluster
4 GP070656 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for XP_008809313.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Dr07514 orthology 0.444 4 199.5 1.4e-51
HORVU1Hr1G072500.1 orthology 0.637 7 163.3 1.4e-40
ORGLA08G0123900.1 orthology 0.665 6 167.5 7.1e-42
Sspon.06G0006620-1A orthology 0.613 4 - -
Sspon.06G0006620-2B orthology 0.623 4 160.6 2.5e-39
Sspon.06G0006620-3C orthology 0.627 5 - -
Sspon.06G0033720-1D orthology 0.623 4 - -
XP_010905917.1 orthology 0.0839 2 265.4 4.1e-71
bradi_pan_p028136 orthology 0.654 6 182 3.65e-59
cocnu_pan_p015352 orthology 0.0782 2 287 2.21e-101
maize_pan_p004511 orthology 0.631 4 164 6.53e-52
musac_pan_p004339 orthology 0.376 3 - -
orysa_pan_p015149 orthology 0.668 6 176 1.02e-56
orysa_pan_p029167 orthology 0.917 6 - -
sorbi_pan_p025104 orthology 0.594 4 164 4.26e-52
sorbi_pan_p025742 orthology 1 5 - -
tritu_pan_p039370 orthology 0.661 7 181 7.02e-59