Gene XP_008809430.1
Sequence ID | XP_008809430.1 add to my list | ||
---|---|---|---|
Species | Phoenix dactylifera | ||
Alias | No gene alias | ||
Length | 154aa | ||
Gene Ontology |
![]()
|
Length: 154 amino acids
>XP_008809430.1_PHODC MGVLDFVSELCSLPKDQRKLRKKQFQTVEMKVRIDCEGCERKVKNALEEITGVSSVLIEP KQNKVTVTGYVDAKKVIERVRRRTGKKAEPWPYVPYDVVPHPYAPGAYDRKAPPGYVRNV LDDPKLAHLVRASSMEERYSSAFSDDNPNSCAIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015397 |
Heavy metal transport/detoxification group1 |
3 | GP040065 | Unannotated cluster |
4 | GP463617 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_008809430.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
ORGLA03G0040300.1 | orthology | 0.505 | 3 | - | - |
Sspon.01G0050820-1C | orthology | 0.529 | 4 | 229.6 | 4.3e-60 |
Sspon.01G0050820-2D | orthology | 0.522 | 4 | 229 | 6.5e-78 |
XP_010933357.1 | orthology | 0.0882 | 2 | 289.7 | 1.9e-78 |
cocnu_pan_p018212 | orthology | 0.0846 | 2 | 287 | 1.56e-101 |
cocnu_pan_p033502 | orthology | 0.0969 | 2 | - | - |
maize_pan_p031380 | orthology | 0.549 | 4 | 229 | 2.91e-78 |
orysa_pan_p027349 | orthology | 0.505 | 3 | - | - |
sorbi_pan_p009526 | orthology | 0.507 | 3 | 229 | 1.73e-78 |