Gene XP_010916342.1


Sequence ID XP_010916342.1  add to my list
Species Elaeis guineensis
Alias No gene alias
Length 387aa
Gene Ontology
Open Display term(s) (1)
biological_process
metal ion transport
GO:0030001 - metal ion transport



Length: 387 amino acids

>XP_010916342.1_ELAGV
MTRDEGFRVLKIQTYILKVSIHCDGCKQKVKKLLQKIEGVYSVSIDLENQRVAVSGNVDS
ETLIKKLAKSGKHAELWSQKTNTQEPKPNQQKQRRQFAAAQTGHKNNNDQGKQRLIQGLR
AFKNQHNKLPSLSSDEEDYDDDDEVEGLDELPFLDMNPINFLRQTGNAAAIAKKNCHGNA
GGNGNGGAGKKCGGNTYQHQIKNKDISQQKGIDISANGKIINGVHLGGGNPNAGVINGVH
LGGGNPNAGEIRRINDKNGMTMGHHGLGRNNVGGFQGNGFPGYARFPSNGEGFGGHRQSP
MMVNMQGYQAHPSSMMTNLRGYNNDMIMHESRHMQPQMMYHRSPQISPYTGYYPCYPNPY
YPVNQSDNSDYGIHLFSDENTRGCIVM




Clustering Level Family ID Family Name
1
Heavy metal transport/detoxification protein superfamily
GP000323		 Heavy metal transport/detoxification protein superfamily
2 GP023608 Unannotated cluster
3 GP040483 Unannotated cluster
4 GP070015 Unannotated cluster
Table 1: This table displays which families the selected sequence belongs to in GreenPhyl clustering ?.


ID Name Type
Heavy metal-associated domain, HMA
IPR006121 		Heavy metal-associated domain, HMA Domain
Heavy metal-associated domain superfamily
IPR036163 		Heavy metal-associated domain superfamily Homologous_superfamily

IPR006121 IPR036163
Figure 1: IPR domains for XP_010916342.1



Homology RBH
Similar Sequence ID Type Evolutionary distance Node distance score e-value
Dr15259 orthology 0.67 5 - -
HORVU3Hr1G004420.1 orthology 0.772 5 - -
Mba02_g23430.1 orthology 0.678 4 - -
Mba03_g01140.1 orthology 0.547 4 248.4 8e-66
Mba10_g22160.1 orthology 0.597 4 - -
ORGLA01G0014900.1 orthology 0.761 5 131.3 1.4e-30
Sspon.03G0019370-1A orthology 0.877 6 - -
Sspon.03G0019370-2C orthology 0.837 6 - -
Sspon.03G0019370-3D orthology 0.822 6 - -
XP_026656869.1 orthology 0.147 2 466.1 3.6e-131
bradi_pan_p041682 orthology 0.704 4 174 3.19e-50
cocnu_pan_p021838 orthology 0.0813 1 469 3.68e-167
cocnu_pan_p035969 orthology 0.0813 1 - -
maize_pan_p016355 orthology 0.915 6 - -
maize_pan_p016830 orthology 0.876 6 142 3.62e-38
musac_pan_p029655 orthology 0.658 4 - -
musac_pan_p029948 orthology 0.593 4 - -
musac_pan_p030748 orthology 0.53 3 293 3.77e-97
musac_pan_p032325 orthology 0.529 4 - -
orysa_pan_p014393 orthology 0.761 5 152 5.92e-42
sorbi_pan_p026568 orthology 0.816 5 125 6.71e-32
tritu_pan_p033683 orthology 0.751 5 - -
tritu_pan_p038784 orthology 0.741 5 - -
tritu_pan_p048092 orthology 0.752 5 - -