Gene XP_010918671.1
Sequence ID | XP_010918671.1 add to my list | ||
---|---|---|---|
Species | Elaeis guineensis | ||
Alias | No gene alias | ||
Length | 317aa | ||
Gene Ontology |
Display term(s) (1)
|
Length: 317 amino acids
>XP_010918671.1_ELAGV MGEKEEKGEEKPKKGDGEKKEGQGEKKKEEGGGKKEEGPPAVVLKVDMHCEGCATKIKRS VKRLEGVEGVKADTAANKLTVLGKVDPWKLKERVETRIRRKVDIISPANPPKKDAAAGDA KKPAEDAKPKAPAVSTVVLKIRLHCEGCIHKIRRTIRKIKGVEEVNFDVPKDLVTVKGTM DAKSLPAILKEKLKRGVDIVQPKKDDGGGGGGGEKKEKGGDGEKKEKGGDGEKKEKGGDG GGGEKKEKGDGGGGEKKDGGKKDDEGKAAPPPAALVAPAPVSEVNRMDYYGPYGYRLEMA HAPQLFSDENPNACSIM
Clustering Level | Family ID | Family Name |
---|---|---|
1 | Heavy metal transport/detoxification protein superfamily
GP000323 |
Heavy metal transport/detoxification protein superfamily |
2 | Heavy metal transport/detoxification group1
GP015545 |
Heavy metal transport/detoxification group1 |
3 | GP040674 | Unannotated cluster |
4 | GP503358 | Unannotated cluster |
Table 1:
This table displays which families the selected sequence belongs to in
GreenPhyl clustering
?.
ID | Name | Type |
---|---|---|
Heavy metal-associated domain, HMA
IPR006121
|
Heavy metal-associated domain, HMA | Domain |
Heavy metal-associated domain superfamily
IPR036163
|
Heavy metal-associated domain superfamily | Homologous_superfamily |
Figure 1: IPR domains for XP_010918671.1
Homology | RBH | ||||
---|---|---|---|---|---|
Similar Sequence ID | Type | Evolutionary distance | Node distance | score | e-value |
Dr03735 | orthology | 0.451 | 3 | 236.9 | 1.6e-62 |
Mba04_g23570.1 | orthology | 0.729 | 3 | - | - |
Mba05_g07210.1 | orthology | 0.616 | 3 | 187.6 | 1.4e-47 |
Mba09_g18610.1 | orthology | 0.707 | 3 | - | - |
XP_010918668.1 | ultra-paralogy | 0.0011 | 0 | - | - |
cocnu_pan_p020181 | orthology | 0.0798 | 1 | 391 | 2.99e-137 |
musac_pan_p015139 | orthology | 0.668 | 3 | - | - |
musac_pan_p024796 | orthology | 0.476 | 2 | - | - |
musac_pan_p030150 | orthology | 0.774 | 3 | - | - |
musac_pan_p036884 | orthology | 0.621 | 3 | - | - |